PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI05G22370.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 391aa    MW: 45039.4 Da    PI: 5.1125
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI05G22370.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.98.5e-174390148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT +Ed +l +++k++G ++Wk++ +  g+ R++k+c++rw ++l
  ORUFI05G22370.1 43 KGPWTSWEDSILEKYIKKHGERNWKLVQKNTGLLRCGKSCRLRWMNHL 90
                     79******************************99************97 PP

2Myb_DNA-binding49.21.2e-1596139146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++++eE+ +++++++++G++ W++ a+ ++ gRt++++k++w++
  ORUFI05G22370.1  96 KGAFSKEEENKIINLHRKMGNK-WSRMAADLP-GRTDNEIKNYWNT 139
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.8333890IPR017930Myb domain
SuperFamilySSF466891.29E-2641137IPR009057Homeodomain-like
SMARTSM007174.8E-144292IPR001005SANT/Myb domain
PfamPF002497.6E-154390IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-214497IPR009057Homeodomain-like
CDDcd001672.77E-114590No hitNo description
PROSITE profilePS5129423.15891145IPR017930Myb domain
SMARTSM007172.6E-1595143IPR001005SANT/Myb domain
PfamPF002491.7E-1496139IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-2598143IPR009057Homeodomain-like
CDDcd001676.22E-1198139No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MHESDSDPDS DRTHWYMSNS DDESFVDKDK DCRRSTVAPL LKKGPWTSWE DSILEKYIKK  60
HGERNWKLVQ KNTGLLRCGK SCRLRWMNHL RPNLKKGAFS KEEENKIINL HRKMGNKWSR  120
MAADLPGRTD NEIKNYWNTR IKKCKNNRSP LYPANVCNDA LNEDQHESAD PNVREKLTNN  180
QLEDTTSMYS APQFSDASIS NILDRRLASK DYDSIEDQRN QIEVVAKYEI PLPVLKTTNN  240
DIFPSASIFA NHGNFKSMME LPLIQFDPNN QFVYSRAYAM HLTNFALLND QSEELLNDTD  300
VLNYVVMKEE LSGGSLSPTI NMPCEAHNSM AASNELVVPR YEGDAPPLQD DFTSYFYLND  360
TNLSIFEDTN ELFLENKLDT KGELVMACYV S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-28391433106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankD886210.0D88621.1 Oryza sativa mRNA for OSMYB5, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015639103.10.0PREDICTED: transcription factor GAMYB
SwissprotA2WW872e-77GAM1_ORYSI; Transcription factor GAMYB
TrEMBLA0A0E0PPA60.0A0A0E0PPA6_ORYRU; Uncharacterized protein
STRINGBGIOSGA017818-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os05g41166.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP154081018
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.13e-58myb domain protein 33